PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 187aa    MW: 21043 Da    PI: 10.4089
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038870.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.1e-181360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l+d+++++G g+W++ ++  g++R++k+c++rw +yl
      Pbr038870.1 13 KGAWSKQEDQKLIDYIQKHGEGRWNSLPKAAGLRRCGKSCRLRWINYL 60
                     79********************************************97 PP

2Myb_DNA-binding48.42.1e-1567110247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+  ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++
      Pbr038870.1  67 GSIGEDEEDLIIRLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 110
                      66679****************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.795860IPR017930Myb domain
SuperFamilySSF466896.36E-2911107IPR009057Homeodomain-like
SMARTSM007171.9E-141262IPR001005SANT/Myb domain
PfamPF002491.2E-161360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-231467IPR009057Homeodomain-like
CDDcd001672.49E-111560No hitNo description
PROSITE profilePS5129424.53561115IPR017930Myb domain
SMARTSM007172.0E-1465113IPR001005SANT/Myb domain
PfamPF002494.2E-1466110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2468115IPR009057Homeodomain-like
CDDcd001671.21E-1071111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MRKPGCDKIE TNKGAWSKQE DQKLIDYIQK HGEGRWNSLP KAAGLRRCGK SCRLRWINYL  60
RPDLKRGSIG EDEEDLIIRL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH IRKKLLKMGS  120
TLDPKKPHDH HDPHLRRGTT ASVPVLQPDA RKPILFASSS SDSMSTGAKI HSNESGLPDL  180
NLDLSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-311011524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009360095.11e-134PREDICTED: myb-related protein Zm38-like
SwissprotQ388512e-66MYB6_ARATH; Transcription repressor MYB6
TrEMBLM5WGQ15e-88M5WGQ1_PRUPE; Uncharacterized protein
STRINGVIT_01s0011g04760.t015e-77(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.13e-65myb domain protein 6